Procurement Request
Home>Supplier>Shouguang Triumph chemical Co., ltd.>CJC-1295

Shouguang Triumph chemical Co., ltd.

Shouguang Triumph chemical Co., ltd.

Certified Store
Trader/Contractor/Dealer
China Shandong Weifang
triumph3@starial.cn
13583611556
0536-7971999

Catalog No. : 863288-34-0

CJC-1295

  • 863288-34-0
  • 20mg/BOXES
  • 易尔(ER)医药
  • 99%
  • China,Shandong,Qingdao
  • 7Day (s)
Packing :
More
Price :
US $35.00 /20mg/BOXES MOQ 1BOXES,20mg/BOXES
  • Product Details & Description

Product Info

Compound CJC-1295
CAS No. 863288-34-0 Catalog No. 863288-34-0 Brand 易尔(ER)医药
Purity 99% Packing 20mg/BOXES Grade
Lead Time 7Day (s) Origin ChinaShandongWeifang Loading Port China,Shandong,Qingdao

PropertiesMore

Density 1.45

Description

CJC-1295


Product Name: Pralmorelin

Synonyms: CJC-1295WithoutDAC86328-34-0;CJC1295withoutDAC;CJC1295;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl;L-Tyrosyl-D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl;CJC-1295(10mg);Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-TyChemicalbookrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide

CAS: 863288-34-0

MF: C152H252N44O42

MW: 3367.89688

Assay: 99%

Appearance: White powder

Request For Quotation

Product

CJC-1295

Cas No

863288-34-0

*Purity
*Quantity
*Valid for
*Shipping To
Contact Person
*Email
*Company/Institute
Notes

I would like to have suppliers recommended by MOLBASE.

I agree to share my contact information to the supplier(s).

Other Supplier Reference

Product Name Purity Packing Lead Time Country Store Name Details
cosyntropin 99% 10mg 5Day (s) China,Shaanxi Baoji Guokang Bio-Technology Co., Ltd Request For Quotation
CJC-1295 98% 1mg,500mg 5 spec 7Day (s) China,Jiangsu Nanjing Peptide Biotech Ltd Request For Quotation
CJC-1295 99% 25kg,25kg 3Day (s) China,Henan
Henan Tianfu Chemical Co.,Ltd
Request For Quotation
CJC-1295 (Without DAC) 98% 1kg 3Day (s) China,Henan
Henan Coreychem Co.,Ltd
Request For Quotation
CJC-1295 >98% 25mg 1Week (s) United States,New York
Boc Sciences
Request For Quotation
CJC-1295 (Without DAC) 98% 25kg 1Week (s) China,Chongqing
chemdad
Request For Quotation
CJC-1295 97% 25kg 7Day (s) China,Zhejiang
Hangzhou Bingochem Co., Ltd.
Request For Quotation
cosyntropin 98% 1kg,25kg 4 spec 7Day (s) China,Zhejiang
Hangzhou Shangjie Chemical Co., Ltd.
Request For Quotation
CJC-1295 98% 1kg,100g 3 spec 7Day (s) United States,New York
Boc Sciences
Request For Quotation
CJC 1295 98% 5mg 7Day (s) China,Henan Zhengzhou FILTER Biotechnology Co., Ltd. Request For Quotation
View All Suppliers